PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G08520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 948aa    MW: 103712 Da    PI: 6.0967
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G08520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.61.2e-28601652152
           RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  OPUNC01G08520.1 601 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 652
                      589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.541591672IPR003035RWP-RK domain
PfamPF020426.6E-26604652IPR003035RWP-RK domain
SuperFamilySSF542771.8E-21844939No hitNo description
PROSITE profilePS5174518.698854936IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.1E-25854935No hitNo description
PfamPF005641.8E-15854935IPR000270PB1 domain
SMARTSM006667.4E-25854936IPR000270PB1 domain
CDDcd064072.32E-33855935No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 948 aa     Download sequence    Send to blast
MEVDPSSSSA GAGAGGEGGG VGDLWPFDSL TTSLLFSSVS TSPQLPPLPA SSSSWLTPPS  60
PLWLFDERQL LPLDMGPPAV PTTAPPAVAA TPKAADSVVV EDVHRTRSGN SDTTSKRVDQ  120
INSKWQFHLS LDDNTDSSCL FKERLTQALR YFKESTDQHL LVQVWAPVKS GDRYVLTTSG  180
QPFVLDQQSI GLLQYRAVSM MYMFSVDGEN AGELGLPGRV YKQKVPEWTP NVQYYSSTEY  240
PRLNHAISYN VHGTVALPVF DPSVHSCIAV VELIMTSKKI NYAGEVDKVC KALEAVNLKS  300
TEILDHPNVQ ICNEGRQSAL VEILEILTVV CEEHKLPLAQ TWVPCKYRSV LAHGGGVKKS  360
CLSFDGSCMG EVCMSTSDVA FHVIDAHMWG FRDACIEHHL QKGQGVSGKA FIYRRPCFSK  420
DISQFCKLEY PLVHYARMFG LAGCFAICLQ SMYTGDDDYI LEFFMPPNCR NEDDQNAFLE  480
SILARMKKCL RTLKVVGNGD SNEICLQISN VLIIENEDLK TNVHFENSEG CFRESPESNG  540
SQRVHEVDNG DNKVSTMSER HLLADDNSQN NGASVGRPNG SGASDSLHKS NKPPERRRGK  600
AEKTISLDVL QQYFSGSLKN AAKSLGVCPT TMKRICRQHG ISRWPSRKIN KVNRSLSKLK  660
QVIESVQGSD AAFNLTSITG PLPIPVGPSS DSQNIEKASP NKVAELSNLA VEGDRDSSLQ  720
RPIENDGNLA ILLSQQGFID ANNNLQLEAD KASHSRSSSG EGSINSRTSE ASCQGSPANQ  780
TFVCKPIAST FAEPQLIPEA FTKEPFQEPA LPLSRMLIED SGSSKDLKNL FTSAVDQPFL  840
ARSSNLALMQ NSGTVTIKAS FKEDIVRFRF PCSGSVTALK DEVAKRLRMD VGMFDIKYLD  900
DDHEWVKLAC NADLEECMEI SRHSGSHVIR LLVSDVTAHL GSSCGSSG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0673190.0AK067319.1 Oryza sativa Japonica Group cDNA clone:J013106K21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613020.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0E0JG460.0A0A0E0JG46_ORYPU; Uncharacterized protein
STRINGORGLA01G0077900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7